You are here: Home » Jewellery And Watches » Belle Fee Nyc

Belle Fee Nyc Jewellery And Watches

Belle Fee Nyc Jewellery And Watches 1 to 30 of 83 First | Previous | 1 | 2 | 3 | Next | Last

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The Vanille Lavane Shampoo by Belle Fee NYC. All natural, gentle shampoo for sensitive, allergy prone, fragile hair and scalp with a beautiful light, relaxing, all natural vanilla lavender scent. Perfect to de stress and perfect for children too. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

Colour: N/A

 
Jewel Street for filtered display

Jewel Street

Product ID: VANILLELAVANDESHAMPOO

 

Price: £15.46

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The French Lavandin Roller & Sachet by Belle Fee NYC. French Lavender essential oil roller and sachet. To heal all boo-boos and repels insect. Place the sachet in closets to repel insects or near your pillow for a good nights sleep. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

 
Jewel Street for filtered display

Jewel Street

Product ID: BFN-FLRS

 

Price: £15.46

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The French Lavender Fine Roller | Essential Oils by Belle Fee NYC. Regenerates skin, heals scars, burns, & breakouts. Anti-inflammatory. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

 
Jewel Street for filtered display

Jewel Street

Product ID: FRENCHLAVENDERFINEROLLER

 

Price: £16.19

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The French Lavender Home Spray by Belle Fee NYC. Pure french lavender home freshener to spray in rooms, on sheets, laundry, in drawers. Inducing calmness, meditative state, relaxation, concentration, excellent for brain function, easing breathing & sleeping. Naturally insect repelling. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

Colour: N/A

 
Jewel Street for filtered display

Jewel Street

Product ID: FRENCHLAVENDERHOMESPRAY

 

Price: £16.93

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The Bougie Lavande Candle by Belle Fe NYC. All natural french lavande candle inducing calmness, meditative state, concentration, excellent for the brain, and repels insects. Always place candle on fire proof plate and don't leave unattended. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

Colour: White

 
Jewel Street for filtered display

Jewel Street

Product ID: BOUGIELAVANDE

 

Price: £16.93

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The English Lavender Herbal Tea by Belle Fee NYC. Traditionally used for aiding digestion, peaceful sleeping, and soothing anxiety. Use one tea bag per teapot. May be enjoyed hot or iced. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

Colour: N/A

 
Jewel Street for filtered display

Jewel Street

Product ID: ENGLISHLAVENDERHERBALTEA

 

Price: £16.93

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The Mint & Lavender VS Car Sickness Spray by Belle Fee NYC. Crisp, refreshing Peppermint, lavender and lemon to alleviate carsickness, nausea, migraines as peppermint relieves eyes, liver, and vagus nerve. Lemon relives liver and nervous system. Lavender relieves eyes, brain, and nervous system. An effective remedy for everyone but especially suited for babies, toddlers, and pets. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

Colour: N/A

 
Jewel Street for filtered display

Jewel Street

Product ID: MINTLAVENDERVS-CARSICKNESSSPRAY

 

Price: £16.93

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The Frankincense VS Allergy Relief by Belle Fee NYCA blend of anti-inflamatory, anti-anxiety, soothing and clearing essential oils to combat allergies, asthma, anxiety attacks, sinus infection, and headaches. Japanese peppermint, frankincense and more for gentle opening of nose , sinus, mind, brain, spirit and respiratory system. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

 
Jewel Street for filtered display

Jewel Street

Product ID: 7687

 

Price: £18.40

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The Intimacy Soap by Belle Fee NYC. A gentle PH-balancing soap enhanced with yeast and bacteria-fighting essential oils to prevent yeast and urinary tract infections as well as ingrown hair and irritation. Follow with an application of Monoi- Lavende oil for proper intimate organ care and ingrown hair prevention. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

Colour: Clear

 
Jewel Street for filtered display

Jewel Street

Product ID: BFN-IS

 

Price: £19.14

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The Eau De Lavande Toner by Belle Fee NYC. A delicate floral flower obtained by lavender distillation caring and all the antibacterial and anti-inflammatory, allergen, astringent and regenerating properties of lavender. Use as a toner to soothe, refresh, desensitize, and moisturize oily, reactive, broken-out skin while restoring proper p H level of the dermis. An effective remedy for acne, rashes, eczema, and sunburns, too. Spray-on face in the morning as a single step cleanser and in the evening as a second step cleanser or during the day if needed. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

Colour: N/A

 
Jewel Street for filtered display

Jewel Street

Product ID: 1234

 

Price: £19.14

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The Eau De Rose Face Toner by Belle Fee NYC. Beautiful rose floral water, your main beauty reflex as a spray of it will calm and soothe any irritations, inflammation, puffiness, itchiness. Floral water adjusts ideal skin ph balance, cleanse skin naturally, moisturizes as rose water plumps up naturally the dermis. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

Colour: N/A

 
Jewel Street for filtered display

Jewel Street

Product ID: 568768

 

Price: £19.14

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The VS Virus Lip Butter by Belle Fee NYC. All natural plant butters infused with Belle Fe unique and secret anti-viral, antibacterial, anti-inflammatory essential oils blend to prevent and treat cold sores occurring on lips ,nose and around eyes. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

Colour: N/A

 
Jewel Street for filtered display

Jewel Street

Product ID: VS-VIRUSLIPBUTTER

 

Price: £20.61

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The French Lavender Room Fragrance by Belle Fee NYC. All natural french lavande room freshener inducing calmness, meditative state, concentration, excellent for the brain, and repels insects. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

Colour: N/A

 
Jewel Street for filtered display

Jewel Street

Product ID: FRENCHLAVENDERROOMFRAGRANCE

 

Price: £23.55

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The Lavender Amethyst Bath Salts by Belle Fee NYC. Tea bags sachets filled with Dead Sea salts, Calcium Magnesium salts, Lavender buds and Amethysts crystals. Use one teabag per spiritual bath ritual , ideal for meditation, relaxation, nervous exhaustion/insomnia relief. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

Colour: N/A

 
Jewel Street for filtered display

Jewel Street

Product ID: LAVENDERAMETHYSTBATHSALTS

 

Price: £25.03

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The Lavender Bunch & Lavandin Roller by Belle Fee NYC. Lavender bunch can be used as a culinary herb, tea, or just as room fragrance. Lavandin roller to use on neck and head for relaxation and headache relief. Or cuts and breakouts to heal skin. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

 
Jewel Street for filtered display

Jewel Street

Product ID: BUNCHOFEDIBLELAVENDERLAVANDINROLLER

 

Price: £25.76

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The Eau De Toilette Tiare by Belle Fee NYC. All natural hamamelis (witchhazel) flower alcohol base. Powdery white gardenia Tiar de Tahiti, fresh pink grapefruit, and a touch of sensual Vanilla too for a light, powdery, soft and uplifting sensual scent. All natural aromatherapy scent. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

 
Jewel Street for filtered display

Jewel Street

Product ID: EAUDETOILETTETIAR

 

Price: £25.76

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The Deep Pink Quartz Pendant by Belle Fee NYC. Deep reddish rose quartz on a gold chain with Swarovski crystal. A unique piece of designer jewellery, perfect as a gift for yourself or someone special. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

Colour: Rose Gold

 
Jewel Street for filtered display

Jewel Street

Product ID: BFN-DPQP

 

Price: £25.76

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The Copper Fairy Pendant by Belle Fee NYC. Handcrafted copper & turquoise fairy pendant spiritually charging on Bergamot Himalayan salts for strength, protection, great for the stressful work environment, health issues. A unique piece of designer jewellery, perfect as a gift for yourself or someone special. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

Colour: Copper

 
Jewel Street for filtered display

Jewel Street

Product ID: BFN-CFP

 

Price: £25.76

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The 14kt Gold Rose Crystal Fairy Pendant by Belle Fee NYC. This handmade pendant is made of 14kt gold and features stunning raw rose quartz gemstone and Swarovski crystals. The beautiful rose colour attracts romance and love, grounds your emotions and protects your heart. Delicate Rose quartz iridescent fairy to awaken your inner sensitive open and joyful child. Love and live fearlessly, attract your soulmate for a new round of spiritual growth in fashion, of course. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

Colour: Pink

 
Jewel Street for filtered display

Jewel Street

Product ID: BFN-GRCFP

 

Price: £25.76

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The Charcoal Monoi Cleanser by Belle Fe NYC. A gentle deep cleansing, detoxifying, and refreshing cleanser for sensitive, oily, breakout-prone skin. Charcoal absorbs pollutants and dirt without drying out the skin. Non-foaming and respecting skin's PH level which is essential in keeping the skins ability to naturally retain moisture and naturally fight bacteria. Leaves skin revived clear supple and calm. Apply a small amount mixed with water to face morning and evening. Massage gently rinse thoroughly with water. Blot clean with towelette and finish with a spray of eau de lavande. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

Colour: Grey

 
Jewel Street for filtered display

Jewel Street

Product ID: 123

 

Price: £27.23

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The Monoi Cold Cream by Belle Fe NYC. A creamy handcrafted makeup remover that gently dissolves oily residue like foundation and pollutants. It leaves skin moisturized, clean, fresh, and supple. Safe for delicate eyelids too, as it removed mascara easily. Use a small amount mixed with water. Gently massage face, rinse with water, then blot with clean towelettes. Follow with a spritz of Eau De Rose as a toner. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

Colour: White

 
Jewel Street for filtered display

Jewel Street

Product ID: 1223

 

Price: £27.97

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The Frankincense Mind Clearer by Belle Fee NYCSmelling salts of frankincense and anti anxiety plants sprinkled with spiritually charged clearing and protecting crystals. Open next to your pillow for a full night rest or next to your computer for focus and harmful radiation absorption or in your office for harmonious work communication and to relief anxiety attack , fatigue, headache by gently inhaling the mind expanding frankincense blend. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

 
Jewel Street for filtered display

Jewel Street

Product ID: FRANKINCENSEMINDCLEARER

 

Price: £27.97

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The French Lavender Amethyst Silk Pillow by Belle Fee NYC. All natural silk pillow stuffed with lavender and amethyst crystals to help relax, ease anxiety, and sleep peacfully. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

 
Jewel Street for filtered display

Jewel Street

Product ID: FRENCHLAVENDERAMETHYSTSILKPILLOW

 

Price: £27.97

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The Tiar Spiritual Candle by Belle Fee NYC. Tahitian white Gardenia all natural candle, all natural TIAR flower essence. Long burning, spiritually white, healthy because all natural in opposition to artificially harmful fragranced paraffin candles. Aphrodisiac, sensuous, warm, enchanting scent. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

Colour: White

 
Jewel Street for filtered display

Jewel Street

Product ID: TIARSPIRITUALCANDLE

 

Price: £28.71

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The 14kt Yellow Gold Snowflake Jasper Heart Earrings by Belle Fee NYC. Handmade 14kt gold earrings with stunning blue Jasper and Swarovski crystals. Energizing and communication easing. Blue Throat Chakra stimulating. A unique piece of designer jewellery, perfect for any occasion and outfit. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

Colour: Blue

 
Jewel Street for filtered display

Jewel Street

Product ID: 44667

 

Price: £29.44

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The 14kt Yellow Gold Garnet Drop Earrings by Belle Fee NYC. Handmade 14kt gold drop earrings with stunning Garnet stones. Grounding and warming. Red Root Chakra stimulating. A unique piece of designer jewellery, perfect for any occasion and outfit. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

Colour: Red

 
Jewel Street for filtered display

Jewel Street

Product ID: BFN-YGGDE

 

Price: £29.44

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The Rose & Rose Quartz Bath Salts by Belle Fe NYC. A tea bag filled with Dead Sea salts, Himalayan pink salts, calcium, magnesium, rose petals and rose quartz. For a spiritual bath ritual to bring faith, calm, healing, and open the Heart chakra. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

Colour: N/A

 
Jewel Street for filtered display

Jewel Street

Product ID: ROSEROSEQUARTZBATHSALTS

 

Price: £30.91

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The Fairy Honey by Belle Fee NYC. Immediate relief from the good FAIRY HONEY, a blend of pesticides free Lavender honey, bee pollen, propolis, royal jelly, CBD oil, lavender extract & flower. Add hot water, enjoy and feel immediately better and in the long run too. Boosts the immune system, heals the digestive system. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

Colour: N/A

 
Jewel Street for filtered display

Jewel Street

Product ID: BFN-FH

 

Price: £32.39

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The VS Virus Home Spray by Belle Fee NYC. Belle Fe's exclusive blend of virus killing floral water distillates to spray over sheets in the bedroom, seat and desk in your work environment to ease breathing problems due to virus , allergens present in the home, air conditioning. Great to prevent colds and flus. The virus-fighting plant blend ensures a great night sleep by holistically purifying the air and surfaces from viruses. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

Colour: N/A

 
Jewel Street for filtered display

Jewel Street

Product ID: VS-VIRUSHOMESPRAY

 

Price: £33.12

 
Shop the best deal

Category: Jewellery and watches

Brand: Belle Fee Nyc

Description: The Pearl Amethyst Fairy Drop Pendant by Belle Fee NYC. A handmade pendant with amethyst & pearl set on a gold chain with a Swarovski crystal. A unique piece of designer jewellery, perfect as a gift for yourself or someone special. About The Designer: Belle Fe NYC specialises in natural cosmetic and beauty products for spiritual healing. Belle Fes speciality is strengthening the immunity function of skin, hair, body and spirit through the unique properties of French Polynesia and Mediterranean pharmacopoeia. To find out more about the designer, please visit Belle Fe NYC.

Delivery cost: 22.08

Colour: Purple

 
Jewel Street for filtered display

Jewel Street

Product ID: BFN-PAFDP

 

Price: £33.12

 
Shop the best deal

Belle Fee Nyc Jewellery And Watches 1 to 30 of 83 First | Previous | 1 | 2 | 3 | Next | Last